PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 146aa    MW: 16576.2 Da    PI: 11.5527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036818.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161763147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+WT+ Ed ll+++++ +G g+W++ ++  g+ R++k+ck+rw + 
      Pbr036818.1 17 RGSWTAREDNLLIQYINSHGEGRWSSLPENAGLLRCGKSCKLRWMNN 63
                     89******************************99**********997 PP

2Myb_DNA-binding46.11.2e-1474114548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      T++ +el+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Pbr036818.1  74 TPD-EELILRLHALLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 114
                      555.577889********.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3031264IPR017930Myb domain
SuperFamilySSF466891.21E-2614110IPR009057Homeodomain-like
SMARTSM007177.3E-131666IPR001005SANT/Myb domain
PfamPF002492.0E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211870IPR009057Homeodomain-like
CDDcd001671.68E-101964No hitNo description
PROSITE profilePS5129421.47965118IPR017930Myb domain
SMARTSM007176.0E-1269116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2271117IPR009057Homeodomain-like
PfamPF002494.9E-1374114IPR001005SANT/Myb domain
CDDcd001674.07E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MLNMGRAPCC SKVGLHRGSW TAREDNLLIQ YINSHGEGRW SSLPENAGLL RCGKSCKLRW  60
MNNLRPGIKR GNITPDEELI LRLHALLGNR WSLIAGRLPG RTDNEIKNYW NTHLSRRFKN  120
PTTGKGTEKQ SSTRKRASKP QKRML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241511825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009359589.13e-97PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB6-like
SwissprotO222642e-57MYB12_ARATH; Transcription factor MYB12
TrEMBLM5WPN01e-70M5WPN0_PRUPE; Uncharacterized protein
STRINGVIT_15s0046g00170.t014e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-58myb domain protein 7